Nucleocapsid protein that mediates the translocation of G-actin from the host cytoplasm to the nucleus, which is fundamental to infection. Participates in regulating nuclear actin polymerization as well as the morphogenesis and spatial distribution of viral capsid structures in the host nucleus. Suppresses 'Lys-48'-linked ubiquitination of the viral protein C42, thus forming a regulatory cascade with C42 to control P78/83 availability as an nucleation promoting factor (NPF).

122 amino acids

MIASINDTDMDTDDNMSQARRNRRNRPPARPSAQTQMAAVDMLQTINTAASQTAASLLINDITPNKTESLKILSTQSVGARSLLEPMQANASTIKLNRIETVNVLDFLGSVYDNTIQVIVTE

13.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Ac102 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here