Actin-binding protein that regulates actin polymerization, filopodia dynamics and increases the branching of proximal dendrites of developing neurons.

Belongs to the ABITRAM family.

173 amino acids

MAAAEALGAARYFTRWYKADVKGRPCEDFCVLQHSNRICVITLAEAHPLLQPGKTITSINYQISPNCSRLQNKVSGKSKRGAQFLTELAPLCRIASSDGEEYTIYSFIRGRLIEVNENILSNPALLQEKPSTEGYIAVVLPKFEESKSVTQGLLTPEEYKEVLLKRQNSSSGS

19.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ABITRAM using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here