Catalyzes specifically the mono-ADP-ribosylation of GcvH-L (SpyM50867). This activity is dependent on prior lipoylation of the target protein. May be involved in the modulation of the response to host-derived oxidative stress. In contrast to other sirtuin classes, lacks protein deacylase activity, being unable to catalyze debiotinylation, deacetylation and desuccinylation of proteins.

Belongs to the sirtuin family. Class M subfamily.

293 amino acids

MSNWTTYPQKNLTQAEQLAQLIKEADALVVGIGAGMSAADGFTYIGPRFETAFPDFIAKYQFLDMLQASLFDFEDWQEYWAFQSRFVALNYLDQPVGQSYLDLKEILETKDYHIITTNADNAFWVAGYDPHNIFHIQGEYGLWQCSQHCHQQTYKDDTVIRQMIAEQKNMKVPGQLIPHCPECEAPFEINKRNEEKGMVEDADFHAQKARYEAFLSEHKEGKVLYLEIGVGHTTPQFIKHPFWKRVSENPNALFVTLNHKHYRIPLSIRRQSLELTEHIAQLISATKTIYQKS

34 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SpyM50869 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here