Product of a dosage-sensitive gene that contributes to the maintenance of paternally and maternally imprinted gene expression in the endosperm in order to balance parental contributions. Underlies postzygotic reproductive isolation by promoting triploid seed arrest in a genetic dosage-dependent manner, thus being a component of postzygotic interploidy hybridization barriers.

264 amino acids

MFSGEGASQIRIAPEDKPIQWCYQILKSRDFKSARYITQMNLKLSKTRHDEYEKGLAICDILIAAENRLPNGLLDCYGMIRMTRPGLVLYQNIEKELNLLGWGNISNPFPFRQEASEKFFFAWSLLSNPTIKEMYDYATSDEVNLEPQGNVNEYMDVDSSSQSGYGLGSVLCSDLPGSEYLKEFADVYPLPLAEKGQAPHNRFGWYDHNVGPETNNNVVVTYEDAKEEECDMSSSSELRIINGRRVKITIEEAAETSDTPSCSR

29.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ADM using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here