Intermedin-short: May play a role as physiological regulators of gastrointestinal, cardiovascular bioactivities mediated by the CALCRL/RAMPs receptor complexes. Activates the cAMP-dependent pathway.

Belongs to the adrenomedullin family.

150 amino acids

MAQLLMVTVTLGCISLLYLLPGTLSGSLGKGLRHSRPREPPAKIPSSNLQPGHPSLQPVVWKSRRHAPQPQGRGNRALAMVHLPQGGGSRHPGPQRPTGSRRPHAQLLRVGCVLGTCQVQNLSHRLWQLVRPAGRRDSAPVDPSSPHSYG

16.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Adm2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here