Pathogenicity determinant (By similarity). May act as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs.

Belongs to the geminiviridae protein AC4/C4 family.

125 amino acids

MFPKKKFLRCFCISRGRSSNRITLESPERNIPTGLRTYTASFNYLENPTSRMLDFSTSLTPDGLPDFTQTFRLPKTPTPSRTTSPKKVIIVNPGNIKCLGVQSQTKTTYITMPLMQVVREKLSTL

14.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make AC4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here