Required for the association between the dense viroplasm and the viral membranes to form the mature virion (MV).

Belongs to the chordopoxvirinae A30 family.

74 amino acids

MDDIDYIDDINEDSINHMLSTLANVRDPEFSATISLMQEVLKIINSRIIEIDKKYKKNNRNINSMNNASSRVSY

8.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FPV194 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here