About Products Protein Database Contact

Protein expression services for psmb6l-a | Proteasome subunit beta type-6-A like protein

Description
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides (By similarity).
Family
Belongs to the peptidase T1B family.
Species
Salmo salar
Length
217 amino acids
Sequence
MERHLMDSQIKGVSTGTTILAVTFNGGVIIGSDSRASIGGSYVSSKTINKLIQVHDRIFCCIAGSLADAQAVTKAAKFQISFHSIQMESPPLVKAAASVLKELCYNNKEELQAGFITAGWDRKKGPQVYTVALGGMLLSQPFTIGGSGSTYIYGYADAKYKPDMSKEECLQFAKNALALAMGRDNVSGGVAHLVVITEEGVEHVVIPGDKLPKFHDE
Mass
23.2 kDa
Simulated SDS-PAGE
Western blot of psmb6l-a recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make psmb6l-a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here