Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization (By similarity).

Belongs to the PSMG2 family.

264 amino acids

MFVPSGDSVPDLAGCTLLMPAVSVGNVGQLAIDLIISTLNMHKIGYFYTDCLVPMVGNNPYATAEENSAELSINAEVYALPSKKLVALQLRSIFIKYKSKSFCEKLLSWVKCSGCAKVVVLSSSHSYHRNDLQLRSTPFRYLLTPSMQKSVQNKIQSLNWEEMEKTPCIPEIDDSEFCVRVPGGGITKLLYDEGCSKEIPIAILLKFVSEGDNIPDALGLVEYLNEWLQIIKPHCEDPTASSLPWKMPSSWRLLFGSGLPPALF

29.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PSMG2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here