Metalloprotease involved in the inhibition of insect antibacterial peptides. Reduces the antibacterial activity of G.mellonella hemolymph by 50%. Reduces the antibacterial activity of cecropin A by 80% and completely inhibits cecropin B.

Belongs to the peptidase M4 family.

371 amino acids

MQIQNNNYKGLIPPYILQNIYKNTSESEKDNVLMTLNHTQSLMLDSVIKTSDSIDNTDDEVVSDTLHRSIYDAKNETKLPGTLVRDEGDPDNGDVAVDNAYKYLEATYNFYKEVFNRNSLDDKGMKLIATVHYGKEYMNAYWGRGQMVFGDGDGKVFNNFTTSIDVIGHELSHGVIEKTADLIYFFQSGALNESIADVFGSLVRQHYLKQKADEASWVVGEELLAKGIKGVGIRSMKEPGKAYDDPLLGKNPQPGHMDDFKDYPIYRDNGGVHVNSGIPNKAFYNLAIKLGGYAWEKAGKIWYNTLLDKDLARDTTFLSFAKLTVKHARDLFDEDVEKATIDSWKEVGIKVKEEDKDKGKDEGKDKAETKV

41.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make prtS using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here