About Products Protein Database Contact

Protein expression services for prsW | Protease PrsW

Description
Involved in the degradation of specific anti-sigma factors. Responsible for Site-1 cleavage of the RsiW anti-sigma factor. This results, after two other proteolytic steps catalyzed by the RasP and ClpXP proteases, in the release of SigW and the transcription activation of the genes under the control of the sigma-W factor (By similarity).
Family
Belongs to the protease PrsW family.
Species
Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Length
215 amino acids
Sequence
MLSILSAGIAPALALLSYIYLKDKITEPIWLIIRMFILGALLVLPIMFIQYAISSEFNYDSIFIEAFFQIALLEEFFKWFVFMFVIYQHEEFDNHYDGIVYASSLSLGFASIENILYLITNGIEYAFLRAVFPVSSHALFGIIMGYYLGKAKTHTNYKKKNLTLAFLLPFLLHGIYNFILKGFSSFTLILTPFMVLLWIIALYRLKRANENTIIN
Mass
24.9 kDa
Simulated SDS-PAGE
Western blot of prsW recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make prsW using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here