Involved in the degradation of anti-sigma-W factor RsiW. Responsible for Site-1 cleavage of the RsiW anti-sigma factor. This results, after two other proteolytic steps catalyzed by the RasP and ClpXP proteases, in the release of SigW and the transcription activation of the genes under the control of the sigma-W factor. Seems to be responsible for sensing antimicrobial peptides that damage the cell membrane and other agents that cause cell envelope stress. Therefore it is a protease governing regulated intramembrane proteolysis and resistance to antimicrobial peptides in B.subtilis.

Belongs to the protease PrsW family.

218 amino acids

MFAIISAGIAPGIALLSYFYLKDQYDNEPVHMVLRSFFLGVVLVFPIMFIQYVLEKENVGGGSFFVSFLSSGFLEESLKWFILMISVYPHAHFDEHYDGIVYGASVSLGFATLENILYLIGHGVEHAFVRALLPVSCHALIGVIMGFYLGKARFSADKARVKWLTLSLVVPSLLHGSYDFILTALSNWIYYMLPFMVFLWWFGLRKAKKARSVNMMQV

24.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make prsW using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here