Involved in the degradation of specific anti-sigma factors, specifically RsiT. Involved in the regulation of extracytoplasmic function sigma factors expression. Seems to play a role in the resistance to antimicrobial peptides. Required for colonization or survival in the host cecum.

Belongs to the protease PrsW family.

238 amino acids

MKLDLFLLAIIPILIGMFWIRSKDRYCREPLIHLIKFFLIGAFLSVIIILLENLLMKFNVFEGYSELIYVSFVVAGLVEEGVKALILIPALIKEKHFTEKLDGIIYSVFLALGFATIENMVYIFSESRNLALQVGINRAVISIPAHVMFAITMGYYISKYKFEGNKNKRREYLFMAVLIPILLHGVFDFILMIEYRWAIILLIVYVIILWKINLDKLEKYMNHSKKVFFGNLRKKKKK

27.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make prsW using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here