Description
Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. Involved in the constitutive production of prostanoids in particular in the stomach and platelets. In gastric epithelial cells, it is a key step in the generation of prostaglandins, such as prostaglandin E2 (PGE2), which plays an important role in cytoprotection. In platelets, it is involved in the generation of thromboxane A2 (TXA2), which promotes platelet activation and aggregation, vasoconstriction and proliferation of vascular smooth muscle cells (By similarity).
Family
Belongs to the prostaglandin G/H synthase family.
Species
Oryctolagus cuniculus
Sequence
MSRSSPSLRLPVLLLLLLLLLLPPPPPVLPADPGAPAPVNPCCYFPCQHQGVCVRVALDRYQCDCTRTGYSGPNCTVPDLWTWLRSSLRPSPTFVHYLLTHVRWFWEFVNATFIRDTLMRLVLTVRSNLIPSPPTYNLDYDYISWEAFSNVSYYTRVLPSVPKDCPTPMGTKGKKQLPDAQVLAHRFLLRRTFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDSLERQYHLRLFKDGKLKYQVLDGEVYPPSVEEAPVLMHYPRGVPPRSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWDDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFDPEMLFSVQFQYRNRIAMEFNHLYHWHPLMPDSFQVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQSAGRIGGGRNIDHHVLHVAVEVIKESREMRLQPFNEYRKRFGLKPYASFQELTGETEMAAELEELYGDIDALEFYPGLLLEKCQPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGSNLIKTATLKKLVCLNTKTCPYVSFRVPRSSGDDGPAAERRSTEL
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service