Functions in trans to edit the amino acid moiety from incorrectly charged Ala-tRNA(Pro). Has weak activity on correctly charged tRNA(Ala), tRNA(Gly) as well as tRNA(Cys), tRNA(Met), tRNA(Pro), tRNA(Ser) and tRNA(Leu).

Belongs to the PRORSD1 family.

164 amino acids

MDMDAKQAVIAKLDELKINYTLIEHDPVYTIEEMEKIDIENVDYIVKNLFLRDAKGRQHYLVVADKDQKIDLKTLQDKIGSTKLSFASEDRLQKYLKLTKGAVSPFGVLNDETAEVEVVFDKNLVGRSCVAVHPNDNSATVVLSYEDLEKIVKANGNTFKAIEL

18.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make proX using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here