Description
Required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate, and for normal rate of chromosomal segregation during anaphase. Plays a role in the regulation of mitotic spindle dynamics. Increases the rate of turnover of microtubules on metaphase spindles, and contributes to the generation of normal tension across sister kinetochores. Recruits KIF2A and ANKRD53 to the mitotic spindle and spindle poles. May participate in p53/TP53-regulated growth suppression (By similarity).
Family
Belongs to the PSRC1 family.
Sequence
MEDLKEDIKFIVDETLDFGGLSPSDSHEEEDITVLVSPEKPLRRGLSHRSNPNAVAPALQGVRFSLGPLSPEKLEEILDEANRLAAQLEECALKDSENAAAGPGRPSPRGKPSPRRETFVLKDSPVRDLLPTVSSWSAPPPSNLTGLRSSDKKGSARAGRVTAGKKPSSIKKESPTCNLFSASKNPGRSPLAQPTLPPRRKTGSGARTVASPPIPVRPAPQSSASNSQCSSWLQGAAAKSSSRLPFPSAIPKPAIRMPLTGRSIPAGKGALAPDPLPTQKGHPSTVGHRAPVSQRTNLPTIGAARGRTSSAARGRVQPLRKAAVPGPTR
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service