Required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate, and for normal rate of chromosomal segregation during anaphase. Plays a role in the regulation of mitotic spindle dynamics. Increases the rate of turnover of microtubules on metaphase spindles, and contributes to the generation of normal tension across sister kinetochores. Recruits KIF2A and ANKRD53 to the mitotic spindle and spindle poles. May participate in p53/TP53-regulated growth suppression (By similarity).

Belongs to the PSRC1 family.

329 amino acids

MEDLKEDIKFIVDETLDFGGLSPSDSHEEEDITVLVSPEKPLRRGLAHRSNPNEVAPALQGVRFSLGPLSPEKLEEILDEANRLAAQLEECALKDRERAGTGPGRPSPRGKPSPRRETFVLKDSPVRDLLPTVSSWSTPPPSSLAGLRSSDKKGSARAVRVASGKKPSSIKKESPTCNLFPASKSPGRSPLAQPILPPRRKTGFGARTTASPPIPVRPVPQSSASNSQCSSRLQGAAVKSSSRLPVPSAIPKPATRVPLIGRSLPPGKGALAPDSLSTQKGHPSAIGHRASVSQKTNLPTTSAARGRTTSAARGRAQPLRKAAVPGPTR

34.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Psrc1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here