Associates with the mTORC2 complex that regulates cellular processes including survival and organization of the cytoskeleton. Regulates the activity of the mTORC2 complex in a substrate-specific manner preventing for instance the specific phosphorylation of PKCs and thereby controlling cell migration. Plays a role in the stimulation of ZFP36-mediated mRNA decay of several ZFP36-associated mRNAs, such as TNF-alpha and GM-CSF, in response to stress. Required for ZFP36 localization to cytoplasmic stress granule (SG) and P-body (PB) in response to stress.

Belongs to the PROTOR family.

368 amino acids

MTRGFTPSLPVEFPKMGSFRRPRPRFMSSPALSDLPRFQAARQALQLSSNSAWNSVQTAVINVFKGGGLQSNELYALNENIRRLLKSELGSFITDYFQNQLLAKGLLFVEEKIKLCEGENRIEVLAEVWDHFFTETLPTLQAIFYPVQGQELTIRQISLLGFRDLVLLKVKLEDLLLLAQPQLPSSIVQMLLILQSVHEPTGPSEGYLQLEELVKQVVSPFLGISEDRGLSGPTYTLARRHSRVRPKVTLLNYASPITPVSRPLNEMALTPLTEQEGEAYLEKCGSVRRHTVANAHSDIQLLAMATMMHSGLGEESGGEDKCLLLQPSFPPPHRQCSSEPNITDGPDEPEQGATGSQEDSELNCASLS

40.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PRR5L using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here