About Products Protein Database Contact

Protein expression services for PRR5L | Proline-rich protein 5-like

Description
Associates with the mTORC2 complex that regulates cellular processes including survival and organization of the cytoskeleton. Regulates the activity of the mTORC2 complex in a substrate-specific manner preventing for instance the specific phosphorylation of PKCs and thereby controlling cell migration. Plays a role in the stimulation of ZFP36-mediated mRNA decay of several ZFP36-associated mRNAs, such as TNF-alpha and GM-CSF, in response to stress. Required for ZFP36 localization to cytoplasmic stress granule (SG) and P-body (PB) in response to stress.
Family
Belongs to the PROTOR family.
Species
Bos taurus
Length
368 amino acids
Sequence
MTRGFTPSLPVEFPKMGSFRRPRPRFMSSPALSDLPRFQAARQALQLSSNSAWNSVQTAVINVFKGGGLQSNELYALNENIRRLLKSELGSFITDYFQNQLLAKGLLFVEEKIKLCEGENRIEVLAEVWDHFFTETLPTLQAIFYPVQGQELTIRQISLLGFRDLVLLKVKLEDLLLLAQPQLPSSIVQMLLILQSVHEPTGPSEGYLQLEELVKQVVSPFLGISEDRGLSGPTYTLARRHSRVRPKVTLLNYASPITPVSRPLNEMALTPLTEQEGEAYLEKCGSVRRHTVANAHSDIQLLAMATMMHSGLGEESGGEDKCLLLQPSFPPPHRQCSSEPNITDGPDEPEQGATGSQEDSELNCASLS
Mass
40.8 kDa
Simulated SDS-PAGE
Western blot of PRR5L recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make PRR5L using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here