Releases the N-terminal proline from various substrates including at least dipeptides Pro-Pro, Pro-Gln, Pro-Trp and Pro-Tyr. Acts also on amides (Pro-beta NA) and oligopeptides including Pro-Leu-GlyNH2, Pro-Leu-Gly, Pro-Phe-Gly-Lys, Pro-Pro-Ala-OBut and Pro-Pro-Gly-(Pro-Pro-Gly)(4). Higher activity toward small peptides (up to three residues), but very low activity for longer peptides. Has no activity against p-nitrophenyl acetate, poly_L-proline, Met-Pro or amino acyl amides other than Pro-betaNA (Pyr-betaNA, Phe-betaNA, Cys-betaNA, Met-betaNA, Leu-betaNA, Ala-betaNA and Z-Gly-Pro-betaNA).

Belongs to the peptidase S33 family.

288 amino acids

MYTEGFIDVTGGRVSFQKFDENGGGTPVIVLHGGPGSSCYSLLGLKALAKDRPVILYDQLGCGKSDRPMDTTLWRLDRFVEELAQIRQALNLDEVHILGHSWGTTLAAAYCLTKPSGVKSVIFSSPCLSAPLWEQDQKRNLKKLPLDVQETINRCEENGTTDSEEFAAAIEVFGKHFVNRLEKQPEWLEQKPSGYRNADIYNIMWGPSEFTVLGNLKNFDCTTQLKEITCPSLYTCGRFDEATPETTEYYSSLTPKSKFHVFEKSAHMPYIEEPEEYLAVIGDFLNSI

32.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make pip using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here