Cleaves H-Pro-AMC as well as a wide spectrum of amino acid substrates and several peptide substrates without a proline at the N-terminus. In conjunction with the three factors F1, F2 and F3, Tricorn degrades oligopeptides in a sequential manner, yielding free amino acids (By similarity).

Belongs to the peptidase S33 family.

310 amino acids

MSYYFITMKGYSINVEEGYKRIFGINIYYKLYRVKGSNRNLVTLHGGPGGSHDYLIPLADLSNYGINVLFYDQFGCGRSDDPKDTSDYTIDHGLEELEELRKQVFGNDKIVLLGHSYGGALAIAYALKYQQFLRGLIVSSGLSSVPYTVKEMRRLIEELPDKYKTIIKRYESLGDFKNPEYLDAVNFFYSQHLLRLKEMPEPVKRTFEYIGKRRTYEIMNGPNEFTIIGTIKDWDVTEQLYKITVPTLITVGKYDEVTVNVAQLIHKNIKGSRLVIFENSSHMAMWEEKDKYLEVIKEFIDQVYSLNMVK

36 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make pip using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here