Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.

Belongs to the profilin family.

125 amino acids

MSWQAYVDDQLVGTGHVIGAAIIGHDGNVWASKNLSLKAGEGAKIVNGFKDSASVLSGGIFVDGQKYLTIKADDKSIYGKKGAGGVVLVKTGQSVLIGHYNETIQPGQATTVVEKLADYLRENGY

13.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PROA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here