Catalyzes endohydrolysis of 1,4-beta-D-glucosidic linkages in xyloglucan with retention of the beta-configuration of the glycosyl residues. Specific for xyloglucan and does not hydrolyze other cell wall components (By similarity).

Belongs to the glycosyl hydrolase 12 (cellulase H) family.

240 amino acids

MKFLTPLVLSSLASAAALNRRADMCGQWDTTTTDKFTLYNNLWGEGNADSGSQCTGLDSDDGNTIAWHTSWTWTGGAGQVKSFANVAYNFEATQLSQLSSIPSTWKWENTGSDIVADVAYDLFTSSSADGDEEYEIMIWLAALGGAGPISSTGSAIATPTVGGQSWSLYSGPNGQMTVFSFVASSTTEDFSADLNDFLKYLQEEQGMPSSQYLTHVQAGTEPFSGSNVKFTTSSYSVSVA

25.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make xgeA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here