Functions in xyloglucan synthesis by adding side chains to the xylosylated glucan backbone. Involved in the galactosylation of hemicellulose xyloglucan.

Belongs to the glycosyltransferase 47 family.

468 amino acids

MDKFNPKKEKTVKKRALKVLTEISPTPLFSMLFLLHISQIATYLSLSDKETLNITVKTKQGGTDTCAGRYVYMHNLPSRFNEDLIKSCEAYIELRNKCKYLINSGFGPRILEEDHNHTTRVLTIETGSWYYTNQFMLEVIFREKMRHYECLTNDSSLSSVVFVPFYAGFDVRRFWGYNVKLRDELGEDLAQWLRERPEWRKMYGRDHFFVTGRVGRDFRRVTDQDSDWGNKLMRLPEFENITMLSIETNSRSNEFAVPYPTYFHPKSRTEVKRWQRQVTMMQRRYLFSFVGANRPKMEESIRGEIIRQCLASQGRCKFLDCDTSSKDCSDPVKVVEVFQDSVFCLQPPGDTPTRRSTFDSILAGCIPVFFSVDSVYNQYKWYFPKDRTKYSVYIAEEGVKKGKVSIEKLLANVSEEKISRMRNEVEKIIPKIIYTKPGEVGPEKIEDAFEIAVARVLERVSLFKMTRI

54.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GT13 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here