A dominant-negative regulator of endogenous whiB2 expression. Low level expression in liquid culture in M.smegmatis leads to elongated and highly branched cells, with multiple nucleoids, similar to the effects seen in deletion experiments for whiB2 in M.smegmatis, as well as loss of acid-fastness. High level expression is lethal. Represses expression of endogenous whiB2. The apo-form binds to the whiB2 promoter found in M.tuberculosis. M.smegmatis cells expressing this protein will not grow on plates. Low level expression in M.smegmatis leads to superinfection exclusion, possibly via modification to the cell wall.

Belongs to the WhiB family.

76 amino acids

MHMHMGGDPSAICAQTDPELWFPDKGQSTRDAKRMCMRCPLLDECRALALRDPHLVGVWGGLSAQERRRIRKGASA

8.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make whiBTM4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here