Protein expression services for niaR | Probable transcription repressor NiaR
Description
Probably functions to regulate transcription of NAD metabolic genes. Binds to DNA upstream of the probable nadBII/nadA/nadC and niaRP operons in a nicotinic acid dependent fashion. Nicotinic acid may be a corepressor.
Species
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Length
175 amino acids
Sequence
MHMKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGGKSGVSRLVAVKHAPEEIKEELLCVVRNGGRIVDVIVEHPVYGEIRGIIDVSSEEEVLKFVNLMEMAKTEPLLTLSGGVHLHTIEAPDEETMERIMRELKKKGFLIEEG
Mass
19.6 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make niaR using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here