Required for the formation of functionally normal spores. Could be involved in the establishment of normal spore coat structure and/or permeability, which allows the access of germinants to their receptor.

205 amino acids

MYDQSVSSYLQNLNSFVQQQAIHIQQLERQLKEIQTEMNTMKQRPATTIERVEYKFDQLKIERLDGTLNIGLNPTDPNSVQNFDVSQSTPQIGMMQQEESAQLMQQIRQNVDMYLTEEIPDILEQLENQYDSRLDDTNRHHVIEDIRKQMDSRIHYYMSHIKKEENTPPAQYAEHIAEHVKRDVIRAVEHFLEHIPSEMKGDEQA

24.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gerPC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here