Plays a functionally redundant role in shifting germ cell sexual differentiation in hermaprodites. Required for the development of somatic gonad structures and for progression from larval stage to adulthood.

Belongs to the splicing factor SR family.

179 amino acids

MDAKVYVGGLPSDATSQELEEIFDRFGRIRKVWVARRPPGFAFVEYDDVRDAEDAVRALDGSRICGVRARVELSTGQRRGGGGRGGGFGGRGGGGRDRSPYRGDRGRSRSRSRDRGRDRSRDRSRDRSRDRSRDRSRERSRERERTRSRSRSPQERDRSHSKSRSRSRSRSRSRSASPH

20.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rsp-6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here