Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.

Belongs to the SPCS2 family.

180 amino acids

MSDERITVVNKWDGPTVKNGLDEVVKKILNDKVGWTEQHNLMNLRLLISFIGVAFSAFACGYDFYAPFPKSKIVLLVCSVSYFICMGVLQLFQWYVEKDCFYEANEVDGKQTRKWAWSSEIKAHDDKYVLSAEFKKEGRSGQGKIIKSIGAYIDNDGEIMIPLVQREVDDLWARLIRSEQ

20.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make spcs-2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here