Serine/threonine-protein kinase which is required for checkpoint-mediated cell cycle arrest and activation of DNA repair in response to the presence of DNA damage or unreplicated DNA. May also negatively regulate cell cycle progression during unperturbed cell cycles (By similarity).

Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. NIM1 subfamily.

414 amino acids

MPKYELQETLASGSTSKVKRAAAPGNAKCVVKVIRKKDVPLRVFLREVKIHRSLRHPNIVGFVDSYEDCHGYCIVMKLGCGEVGSMIRAGGGLDPLLAHFYFRQLVSAVEYLHGKCICHRDIKPENMLIDSAGNLLLSDFGFSTVFFHKGRRRRLRSPAGSLEYMAPEVFEGAYDGELADVWSCGVSLVVFLTGALPWDRAVESDERFSAFVSSRGGCQVPLSSIGDQAMGLVMRMTAKEDRRPSVSTVMKDPWVMQPNELLDESGLCRDSCRLFSLVPRQTGSALHFTQPGEVHKTPRTRPVSSQPRRAGSGDICRVYIGEESLRLALRRVCEALDGMVVSHRIAKEHVMFSTVDSRRSVLSGEVGVIRLDEGCCMTIRRAKGDPQEFKRFTRVLAESLGCNGRKCTILYNEI

46 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CHK1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here