Could be involved in the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine.

Belongs to the protein kinase superfamily. Tyr protein kinase family. BUD32 subfamily.

195 amino acids

MKVYLGGEAEVKILENVVVKTRIPKRYRIKELDRELRLRRTKMEAKIISAARRAGVPTPIVLDVEEDTIVMERIYGEAVKDVMSKDVSREVGRMAAKLHRAGIIHGDITPMNLILSNSRIYFVDFGLAFFDNKVEPMGVDVHVYFESLKASFENWERLRDAFIEGYLAEGGSEEVIERAKEIEERGRYVERVSMG

22.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make AF_0665 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here