About Products Protein Database Contact

Protein expression services for rsmA | Probable ribosomal RNA small subunit methyltransferase A

Description
Specifically dimethylates two adjacent adenosines in the loop of a conserved hairpin near the 3'-end of 16S rRNA in the 30S particle. May play a critical role in biogenesis of 30S subunits.
Family
Belongs to the class I-like SAM-binding methyltransferase superfamily. rRNA adenine N(6)-methyltransferase family. RsmA subfamily.
Species
Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Length
271 amino acids
Sequence
MVRSILKKYNIKGGTFDQHFLIDAGYLDRIVAAAELSPQDTVLEIGAGIGNLTERLARRAKKVIAVELDPALVSVLHDRFDAAENIEIIAGDALKVDFPEFDKVVSNLPYSISSEITFKLLRHKFKLGVLMYQYEFAVRMVSPPGCKDYSRLTIDTCYFADASIVMKVPKGAFQPAPEVDSAVIKLIPRPAPFEVRDETFFLQFVAAVFSQRRKKLRNAILNTSSLLKIPDIKEIVSQLPEDFMNKRAEDLTPEELASVANMIFDLKSRNF
Mass
30.5 kDa
Simulated SDS-PAGE
Western blot of rsmA recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make rsmA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here