Probable RNase involved in rRNA stability through maturation and/or degradation of precursor rRNAs. Binds to RNA in loop regions with AU-rich sequences.

Belongs to the FAU-1 family.

412 amino acids

MKVRIRGIYATALTKLFLDNGFEIVQATPQISDRFSLPIRAEPSDVTIKDGNDKGELISIGEDIYSFLRKTFQNSFIWKSPVRLYSVIETNNCKFMDYQVEPCLDKGLVVKPPSEGRIILSSPKAVGKYSMVWRGDGKTFFSEHIRDREEKTRLLSISIPFNKKGYNVKWRSNAPFASNIVLKEELEKLAIRFDNNDFRQQGEDFIKVTVSLEDKIMLDEIRKKVLPNTIRFHHMLKMSFSNEVDEIEQTSMNNEELLDKLITDYMGIEHIKPDGRKFELKEGKVIYKEVNSDYYIVRLMRVFSREGIYDGLNVKKEEGDYDIVEFDSRKWYQIHRYYNKDGKLKGIYVNISTPPELLRGKLRYLDLEVDVVKVGDEVRIIDLEELEKNKEIIGETMYKKIFTIIEEVKKIL

48.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fau-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here