Probable reductase that might be involved in the reduction of lariciresinol into secoisolariciresinol. In most plant species, a single enzyme is able to reduce both pinoresinol and lariciresinol efficiently while in Arabidopsis, PRR1 and PRR2 show a strict substrate selectivity for pinoresinol.

Belongs to the NmrA-type oxidoreductase family. Isoflavone reductase subfamily.

306 amino acids

MEEEKKKSRVLIIGATGRLGNYLTRFSIESGHPTFALIRNTTLSDKLKSLSDAGVTLLKGSLEDEGSLAEAVSKVDVVISAIPSKHVLDQKLLVRVIKQAGSIKRFIPAEYGANPDKTQVSDLDHDFYSKKSEIRHMIESEGIPYTYICCGLFMRVLLPSLVQPGLQSPPTDKVTVFGDGNVKAVFVNDVDVAAFTIKTIDDPRTLNKTLYLSPPGNICSMNDLVELWEGKIEKKLEKTFATENQLLKKIKETPYPDNMEMVFIYSVFIKGDHTYFDIESCGGVNGTELYPDVKYMTVSEFLDTLL

34.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PLR3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here