About Products Protein Database Contact

Protein expression services for MSS4 | Probable phosphatidylinositol 4-phosphate 5-kinase MSS4

Description
Catalyzes the phosphorylation of phosphatidylinositol 4-phosphate on the fifth hydroxyl of the myo-inositol ring, to form phosphatidylinositol 4,5-bisphosphate. Acts downstream of STT4, but in a pathway that does not involve PKC1. May be involved in the organization of the actin cytoskeleton.
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Length
779 amino acids
Sequence
MSVLRSQPPSVVPLHLTTSTSRKTEQEPSLLHSAIIERHQDRSVPNSNSNPDSNHRIKKDRNNHTSYHSSSNSESNMESPRLSDGESSTPTSIEELNPTINNSRLVKRNYSISIDPLHDNSNNNTDDDHPNTITSPRPNSTSNKEMQKYSFPEGKESKKITTPSLNSNNCLDLDNSSLVHTDSYIQDLNDDHILLNKRVSRRSSRISAVTATSTTIKQRRNTQDSNLPNIPFHASKHSQILPMDDSDVIKLANGDTSMKPNSATKISHSMTSLPLHPLPQPSQKSKQYHMISKSTTSLPPENDHYYQHSRGTNHNHAANAAAVNNNTTTTTAATGLKRSESATAEIKKMRQSLLHKREMKRKRKTFLVDDDRVLIGNKVSEGHVNFIIAYNMLTGIRVAVSRCSGIMKPLTPADFRFTKKLAFDYHGNELTPSSQYAFKFKDYCPEVFRELRALFGLDPADYLVSLTSKYILSELNSPGKSGSFFYYSRDYKYIIKTIHHSEHIHLRKHIQEYYNHVRDNPNTLICQFYGLHRVKMPISFQNKIKHRKIYFLVMNNLFPPHLDIHITYDLKGSTWGRFTNLDKERLAKDRSYRPVMKDLNWLEEGQKIKFGPLKKKTFLTQLKKDVELLAKLNTMDYSLLIGIHDINKAKEDDLQLADTASIEEQPQTQGPIRTGTGTVVRHFFREFEGGIRASDQFNNDVDLIYYVGIIDFLTNYSVMKKLETFWRSLRHDTKLVSAIPPRDYANRFYEFIEDSVDPLPQKKTQSSYRDDPNQKNYKD
Mass
89.3 kDa
Simulated SDS-PAGE
Western blot of MSS4 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make MSS4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here