Pectinolytic enzymes consist of four classes of enzymes: pectin lyase, polygalacturonase, pectin methylesterase and rhamnogalacturonase. Among pectinolytic enzymes, pectin lyase is the most important in depolymerization of pectin, since it cleaves internal glycosidic bonds of highly methylated pectins (By similarity).

Belongs to the polysaccharide lyase 1 family.

476 amino acids

MTLLRHLLTATALLGASVQAAQGVTGSPFGFASGTTGGGDATPAAPSDISQLKTWLSDSTPRVILIDKEFNFLGSEGKCTNCECCKPASNTCGSSGQNAVKQNGSDWCGSYPTLTCTYDNAGIEGLEVASNKSIVGVGSSGVLRGKGLRLVNGVSNIIIQNIHITELNPEFIWGGDAITLDGTNNVWIDHVKINLIGRQMFVAGYEASHSVTISNSEFDGETSWSATCDGHHYWTVLGYGHNDKITFANNYIHHTSGRSPKLEFNSFWHAYNNYWYNNTGHAFDVGKNTRALIEGNVMVQVDTPLLADSNPGAVFAVNTSDVSTCTSTLGRTCVPNTLISSGTLSGSDSSVISSWPSGESDVTVMAASKVASYVKANAGIGKLGNGSGSSSTVGAAATSAVAKRADSDDAPFVPAYSEAGPGASAVPTQPSWSWRTVTNGPAPTGAPSDSPSAPQGLGAPVQASNKHHHQGHGRGY

49.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make pelF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here