Involved in the biosynthesis of the antibiotic phenazine, a nitrogen-containing heterocyclic molecule having important roles in virulence, competition and biological control. This isochorismatase may remove pyruvate from chorismate during the formation of the phenazine ring structure and/or stabilize the phenazine biosynthetic complex.

Belongs to the isochorismatase family.

207 amino acids

MTGIPSIVPYALPTNRDLPVNLAQWSIDPERAVLLVHDMQRYFLRPLPDALRDEVVSNAARIRQWAADNGVPVAYTAQPGSMSEEQRGLLKDFWGPGMKASPADREVVGALTPKPGDWLLTKWRYSAFFNSDLLERMRANGRDQLILCGVYAHVGVLISTVDAYSNDIQPFLVADAIADFSKEHHWMAIEYAASRCAMVITTDEVVL

23.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make phzA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here