Phosphatase that hydrolyzes non-canonical purine nucleotides such as XTP and ITP to their respective diphosphate derivatives. Probably excludes non-canonical purines from DNA/RNA precursor pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions.

Belongs to the YjjX NTPase family.

179 amino acids

MARHKLRIVAVGSTNPVKIEAVKEGFEKVLGAVEVIGVDVISGVSSHPIGLEETYLGALNRAKNAFEKVQCTYAVGIEAGLIKVGEHYIDIHICVVFDGVNETVGLSQGFEYPKIVAEKVLEGIEGGKIAEEISGIKDIGKNIGLIGYLTDNNITRKDLCRESVIMALIPRMIKNAHLY

19.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MJ0261 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here