Protein expression services for BTH_II0599 | Probable inner membrane protein BTH_II0599
Description
(Microbial infection) Probably transports the toxic C-terminal region of CdiA-2 from B.pseudomallei strain 1026b across the inner membrane to the cytoplasm, where CdiA has a toxic effect. Expression in E.coli makes the bacteria sensitive to the tRNase domain of B.pseudomallei strain 1026b CdiA-2.
Species
Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
Length
270 amino acids
Sequence
MQLIEVSAKTGYVWFRQGIWLFRRNPLAFVTLFFTYLLAMMLVSLVPVIGAALPLLLIPGIAVGFMAACRDTIAGKQVLPTILIDGFRSYGPIVTQRLLTLGGLYIVSMAAVFACSALGDGGTLLKIMFGLGAENLGPDALESPGFKIAALIAAALYAPVAMMFWFAPVLTAWHDVPPVKALFFSVVSCWRNKGAFTVYGLLWFALALGVSFGLAALMQALGASAYALMVMMPASIVITAMLYCSFYATYRGCFGVQEPGAPKLPNTSDR
Mass
29 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make BTH_II0599 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here