Involved in auxin biosynthesis. Both isoforms are catalitically active. Involved during embryogenesis and seedling development. Required for the formation of floral organs and vascular tissues. Belongs to the set of redundant YUCCA genes probably responsible for auxin biosynthesis in shoots.

Belongs to the FMO family.

411 amino acids

MGTCRESEPTQIFVPGPIIVGAGPSGLAVAACLSNRGVPSVILERTDCLASLWQKRTYDRLKLHLPKHFCELPLMPFPKNFPKYPSKQLFISYVESYAARFNIKPVFNQTVEKAEFDDASGLWNVKTQDGVYTSTWLVVATGENAEPVFPNIPGLKKFTGPVVHTSAYKSGSAFANRKVLVVGCGNSGMEVSLDLCRYNALPHMVVRNSVHVLPRDFFGLSTFGIAMTLLKWFPLKLVDKFLLLLANSTLGNTDLLGLRRPKTGPIELKNVTGKTPVLDVGAISLIRSGQIKVTQAVKEITRNGAKFLNGKEIEFDSIILATGYKSNVPDWLKENSFFTKEGMPKTPFPNGWKGEKGLYTVGFTRRGLSGTAYDAVKIAEDITDQWMKFNGPLSCRNICSSHIIHLHFNKS

45.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make YUC4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here