Probable glycosyl transferase; part of the gene cluster that mediates the biosynthesis of cytokinins such as fusatin, fusatinic acids or 8-oxofusatin, known for their growth promoting and anti-senescence activities toward host plants (PubMed:28802024). FCK1 is a bifunctional enzyme that performs the first steps in the biosynthesis of Fusarium cytokinins (PubMed:28802024). It first condenses adenosine monophosphate (AMP) with dimethylallyl diphosphate (DMAPP) to yield isoprenyl adenosine monophosphate (PubMed:28802024). It then catalyzes the removal of the phosphoribose to produce isopentenylaldehyde (PubMed:28802024). The cytochrome P450 monooxygenase then converts isopentenylaldehyde to trans-zeatin (PubMed:28802024). A condensation step converts trans-zeatin to fusatin which is further modified to produce fusatinic acid (PubMed:28802024). The mechanism for oxidation of fusatin to fusatinic acid remains unknown (PubMed:28802024). 8-oxofusatin could be produced through several pathways, via direct oxygenation of fusatin, or via the 8-oxo-pentenyladenine intermediate which itself must arise from either the prenylation of 8-oxo-AMP by FCK1 and/or oxygenation of isopentenylaldehyde (PubMed:28802024). Both the FCK3 and FCK4 enzymes act downstream of the identified cytokinins to produce yet unidentified compounds (PubMed:28802024).

394 amino acids

MHFAIPLEYQSELEATEPVDVGTDEEIISSIEQYRPVTSEKNIWAFWDSGILSMPSWCKRNVIGWARICGADWTIRVLDMKPNSPNHVLKFIDRDMLPEAFLSGTMDGHHTGQHSADFIRGPLLHHYGGVSMDVGCLLIRHIDRICWDLLADPDSPYEIAVPVLYDQTIANHFIAARKNNIFIEKWHQLFLHLWNGRTHQQGISDSPLLGFIKDIRYDDATDFHWDWSVPVPQFLEYIAQVLCWQRLCLIRDTGDGFKSSEYWQRNVLCIDSLNEVWGGEKTLGFDGIGPRMYNLLTTRLDADPDSTAYKDAYKLVWRLLTRSSFQKVTRAKNLTYTPHLGTLWDQNEGKDCIPGSFGELLRYGPVHFRQKRENIEQLEASEPRTLIEKGLLEV

45.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FCK3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here