May constitute a glutathione peroxidase-like protective system against oxidative stresses. Involved positively in abscisic acid (ABA) signaling pathway that regulates numerous ABA responses, such as stomatal closure, seed germination and inhibition of vegetative growth. Oxidizes and represses target proteins (e.g. the phosphatase activity of ABI1 and ABI2) when oxidized by H(2)O(2), probably after ABA signaling. Modulates the calcium channel activity in guard cells in response to ABA or H(2)O(2). Confers tolerance to drought stress, by enhancing the ABA-dependent stomatal closure.

Belongs to the glutathione peroxidase family.

206 amino acids

MPRSSRWVNQRATSKIKKFILFLGVAFVFYLYRYPSSPSTVEQSSTSIYNISVKDIEGKDVSLSKFTGKVLLIVNVASKCGLTHGNYKEMNILYAKYKTQGFEILAFPCNQFGSQEPGSNMEIKETVCNIFKAEFPIFDKIEVNGKNTCPLYNFLKEQKGGLFGDAIKWNFAKFLVDRQGNVVDRYAPTTSPLEIEKDIVKLLASA

23.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GPX3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here