Gas vesicles are small, hollow, gas filled protein structures that are found in several microbial planktonic microorganisms. They allow the positioning of the organism at the favorable depth for growth. This protein could be important for the shape determination of the gas vesicle (By similarity).

Belongs to the gas vesicle protein type A family.

114 amino acids

MTDLDHRYPGEETEPYGPPSGSLADLLERVLDKGIVIAGDIKIDLLDIELLTIRLRLFIASVDTAKKAGIDWWETDPALSSRAARDALAEENARLRERLDALEGAAGETTGAVR

12.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gvpJ2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here