Involved in degradation of plant cell walls. Hydrolyzes the feruloyl-arabinose ester bond in arabinoxylans, and the feruloyl-galactose ester bond in pectin. Active against paranitrophenyl-acetate, methyl ferulate and wheat arabinoxylan (By similarity).

Belongs to the faeC family.

272 amino acids

MVPTMIYSAILALSAFTPSVLAQTRSSGCGKQPSLTNGVHNINGREYILKVPDNYDKNKAHHLVFGLHWRGGNMWNIVDGQSVQPWYGLETRAQGSTIFVAPNGKNAGWANNGGEDIAFIDAIIKQVEGDLCVDQSSRFATGFSWGGGMSYSLACSRAKQFRAVSVLSGGVISGCDGGNDPIAYLGIHGINDGVLPFQGGVNLAQKFVKNNRCQQANVGTPQPGSHGSVRTDFKGCSKPVSFIAYDGGHDAAPLGVGSSLAPDATWKFFMAA

28.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make faeC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here