Involved in degradation of plant cell walls. Hydrolyzes of the feruloyl-arabinose ester bond in arabinoxylans as well as the feruloyl-galactose and feruloyl-arabinose ester bonds in pectin (By similarity).

Belongs to the tannase family.

526 amino acids

MTKLSLLPLLTLASAVLAKQDAFQAKCASFGRKIKLPNVHVNFVEYVPGGTNLTLPDNDVTCGASSQVVSADMCRVAMAVDTSKSSQITLEAWFPREYTGRFLSTGNGGLSGCIQYYDLAYTAGLGFATVGANNGHNGTSGKPFYQHPEVIEDFAYRSIHTGVVVGKQLTKMFYKEGFDKSYYLGCSTGGRQGFKSIQKYPNDFDGVVAGAPAFNFVNLISWSIHFYSITGSNTSDTYLSPESWKVVHDEIVRQCDEIDGAKDGIIEDTDLCQPVIETIICKPGASDKTNCITGAQAKTVRNVLSPFYGVNGTLLYPRMQPGSELFASSVVYNGQPFRYSTDWYRYVVYNNPDWDATKWTVEDAAVALAQNPYNIQTWDADISSFQKAGGKVLTYHGMQDQLISSDNSKLYYARVAEEMGLGPEELDDFYRFFPVSGMAHCTGGDGAYGIGNGLRTYNGAEPENNVLMAMVQWVEKGIAPEFIRGAKFSNGVGSSVEYTRKHCRYPRRNVYKGPGNYSDENAWECV

57.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make faeB-2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here