Involved in the degradation of asparagine-linked glycoproteins. May hydrolyze of N-acetyl-beta-D-glucosamine (1-4)N-acetylglucosamine chitobiose core from the reducing end of the bond.

Belongs to the glycosyl hydrolase 18 family.

373 amino acids

MKIFIIISLILTILIIQSKSKECPCSNVELCKPLEIGPRKEFIGFSVNSTFYPYYNWDHLTTIGIFYSEDIEDELLCMAKTNGVRLVYSAFYPVEQLSNETYIDQWINEKLELVQNTFTDGLNFDVEYPITDPIVAQQYTQLVAATNNAFKSVNLYYQISVDVAWDASNCIDYRCYDYLGLSKASDFLVVMDYDMKLDGYYFKTCLASANSPPSSVLSGMVNFTKLGIDESSLVMGLPWYGYNYPCIGSNYTLQTFECIIPPSSYLGYNCTDASGIEINYSIIMNMLNDTAIQNGGVQWDSESESPYFNFIDLFSGTQHQMWFDNPDSLTIKVNIARTMNLRGVGVWNIDQLWDDHSLSSGMWGALNSFFKIN

42.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ctbs1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here