Transpeptidase that recognizes and modifies its substrate by proteolytic cleavage of a sorting signal. Following cleavage, a covalent intermediate is formed via a thioester bond between the archaeosortase and its substrate, which is then transferred and covalently attached to the cell membrane.

Belongs to the exosortase/archaeosortase family. Archaeosortase E subfamily.

184 amino acids

MGSLLMERNFMVEDTFTNGKLSKKEKILFLIKFYIIFLVVFFILSYFGKYLIGIVTYLSYIFTKIIISDARLADNFIYLPNNTVEVVEECTGSFLIAGLLALIIVYSKNIKEFIIGIFFVLLAFFVNIFRIVLICYLVNMHPESSYLYHEIAGYGVILTLVPVLVIGYLKIIEKYRHSSNKSHL

21.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make artE using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here