Endogalactanase involved in the degradation of plant cell wall polysaccharides, and more particularly of hairy regions of pectin.

Belongs to the glycosyl hydrolase 53 family.

347 amino acids

MLFSYLLATLPLLANAALTYKGADISSVFIEEKAGVAYKNLAGETQALEAILTDNGVNSIRQRVWVKNGDYDLTYNVNLAKRVAATGASIYLDLHYSDDWADPKHQTTPDGWSTDDINTLADQIYQYTLSVCNTFAEEKINVEIVSIGNEITSGLLWPLGKTPNYENIARLLHSGAWGVKDSKLATKPKILIHLDNGWDWDQQKYFYDTALGTGLLTSDDFDMIGVSYYPFYNEKATLASLKTSLTNIQTTYGKEVAVVETNWPVKCSSPEFAFPADLKDIPFSVDGQVTFLQRLAETLTATKASGFFYWEPAWTKNAGLGSSCEDNLLVDYNTNQVRNSVKAFGQV

38.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make galA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here