Hydrolyzes a variety of simple alpha-D-galactoside as well as more complex molecules such as oligosaccharides and polysaccharides.

Belongs to the glycosyl hydrolase 27 family.

532 amino acids

MDTTKSLLSTLIAIMIPLSLGSVSSPNLLPTPPMGFNNWARFMCDLNETLFLETASAMISTGLLEAGYNRVNLDDCWMAYDRAADSSLQWNTTKFPHGIPWLARHLKAQGFHVGIYEDAGNLTCGGYPGSFGHEALDAQTFAAWGIDYLKLDGCNVFPEHSRTLEEEYKARYAHWHSILKQMHHPLIFSESAPAYFADPANLTSWYEVMDWVPAFGELARHSTDILVYVGEGSAWDSIMVNYRYNTLLARYQRPGYINDPDFLIPDHPGLTLEEKRSQFALWASFSAPLIVSAYIPGLSSEELAILRNEELIRVDQDVLGLQATLASRGLEVDVLTRSLEGGDRLLTVLNRGDGVAVVSVPVEWMGLQRGCPYVVKNLWDGEVQVLEEEIVIRLNSHATQVYRIALPDECSTVIPTGIVFNTASGNCLTDENGERVGFEACRGSETQIWQVSELGYLRPLSRTSHCLTGGSQASVQLCTEQKNQQWAYAITGILKNEHTEMCLTEGTGISQCGFERDSQVFGLPSGVDIKPS

59 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make aglA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here