Alpha-L-arabinofuranosidase involved in the degradation of arabinoxylan, a major component of plant hemicellulose. Acts only on small linear 1,5-alpha-linked L-arabinofuranosyl oligosaccharides (By similarity).

Belongs to the glycosyl hydrolase 51 family.

505 amino acids

MTTFTKLSEQETPSISVHASRRISKINPNIYAGFTEHMGRCIYGGIYDPGNPLSDENGFRKDVLEALKELNIPVIRYPGGNFTATYHWIDGVGPKDQRPARPELAWLGTETNHFGTDEFMKWCELLGTEPYFCLNFGTGTLDEALAWVEYCNGTKDTYYANLRRKNGREEPYNIKYWALGNEVWGPWQVAQMTKEEYAHKAYQWAKALKLLDPSLKLILCGQDGTASWDYYTLKQCLLPAHSPLSTSTVPLIDMHSIHMYTCGSTHLPNVTAPLAAERAIEITSSLIDLAMIENGIPPDQPRPTICFDEWNVWDPLRAEGSKGAEESYTLSDALAVAIWLNVFVRKSKDVGMACIAQSVNVISPLMTTKDGIIKQTIWWPLYLFSKYMRGWTINAHVSCGAYEGETSPKWIRAVKDTPWLDVSATLGEDGYANVAVVNISDEKDMECKFEGATGDVTVFTVTGDSVSACNMKGKEEVGLTESTWDGKGAYKFPRHSLTLLRWKAE

56.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make abfC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here