Together with AlgI and AlgF, forms an inner membrane complex which probably interacts with the alginate polymerization-transport complex and adds acetyl groups at the O-2 and O-3 positions of mannuronate residues. Acetylation of alginate is important for the architecture of biofilms and increases the ability of alginate to act as a defense barrier (By similarity).

Belongs to the AlgJ family.

391 amino acids

MTRSLRILYIAIFLGILLILGAWSLRSFSNFSTSAETTVLNGKWTKAAETHYDDEFPIKRLGTNLWAALDFKLFNEGRPGVVLGKDQWLYTDEEFDAVANGEQNEADNLALIQGVRDALEKQGSKLVLAIVPAKTRLYPEHIGDNKPASLHADLYQQFHAQVAKAGIFAPDLLAPLQAAKQQGQVFLRTDTHWTPMGAEVAAQQLGAAIAQKAPLEGEPEQFVTQAIETAPYKGDLTTFLPLDPLFSNLLPKPDELQKRSTDPVAGEAAGGDALFADSDVAVGLVGTSYSANPNWNFVGALKQALRSDVVNYAEDGHGPILPMLKYLQTDAFKNTPPQVVIWEFPERYLPAHNDLGEFDPKWIAELKKSRDTQENVALNAKPSESPNRAQN

43 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make algJ using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here